Protein coding transcript 193182

• Transcript: Ll_transcript_22393
• CDS coordinates: 382-888 (+)
• Peptide sequence: MEKVASSIILSFLICAILVLKVSANAEGDALNALKSNLDDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLTGQLVPQLGQLPYLQYLELYSNNISGKIPDEIGNLTNLVSLDLYLNKLNGPIPNTLGKLANLRFLRLNNNSLSGGIPMSLTTVSSLQVL*
• ORF Type: complete

Annotations of Ll_transcript_22393

• Blastp: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 from Arabidopsis with 80.79% of identity
• Blastx: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 from Arabidopsis with 75.16% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G33430)
• CantataDB: Link to cantataDB annotations (CNT0000466)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419320.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;