Transcript | Ll_transcript_22393 |
---|---|
CDS coordinates | 382-888 (+) |
Peptide sequence | MEKVASSIILSFLICAILVLKVSANAEGDALNALKSNLDDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLTGQLVPQLGQLPYLQYLELYSNNISGKIPDEIGNLTNLVSLDLYLNKLNGPIPNTLGKLANLRFLRLNNNSLSGGIPMSLTTVSSLQVL* |
ORF Type | complete |
Blastp | BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 from Arabidopsis with 80.79% of identity |
---|---|
Blastx | BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 from Arabidopsis with 75.16% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT4G33430) |
CantataDB | Link to cantataDB annotations (CNT0000466) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419320.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer