| Transcript | Ll_transcript_432197 |
|---|---|
| CDS coordinates | 1-327 (+) |
| Peptide sequence | AGTAEVEIKIENNVSKNVAVCRTDYPGTESETVPLNTKPGKEYPLTCPDADNYYNWKGGKTSAQYYVNPMGVSVKDACQWGSADNPWGNFAPMNLGVGYSGGRAWLSIF |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Probable secreted beta-glucosidase ARB_04747 from Trichophyton with 56.86% of identity |
| Eggnog | SUN domain protein (Uth1)(ENOG4111GRE) |
| Kegg | Link to kegg annotations (ARB_04747) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003543763.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer