Protein coding transcript 193286

• Transcript: Ll_transcript_21897
• CDS coordinates: 220-636 (+)
• Peptide sequence: MQLNASRIKVLQAQDDVVNNMKDAAAKELLNVSGDHNVYRNILKDLIVQSLLRLKEPSVLLRCREDDLQLVESVLDLAVQEYAEKANVHAPEIIVDKEVYLPPAPSDDNSHALHCSLRMLPEIVLAAQLLYMKILVSL*
• ORF Type: complete

Annotations of Ll_transcript_21897

• Blastp: V-type proton ATPase subunit E1 from Arabidopsis with 71.55% of identity
• Blastx: V-type proton ATPase subunit E from Citrus with 75.32% of identity
• Eggnog: Produces ATP from ADP in the presence of a proton gradient across the membrane (By similarity)(COG1390)
• Kegg: Link to kegg annotations (AT4G11150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444647.1)
• Pfam: ATP synthase (E/31 kDa) subunit (PF01991.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;