Protein coding transcript 19329

• Transcript: Ll_transcript_418085
• CDS coordinates: 449-1024 (+)
• Peptide sequence: MANEGDKGNDFYGVLGLNKECTESELRIAYKKLALKWHPDRCSASGNSKFVEEAKKKFQAIQQAYSVLSDANKRLMYDVGVYDSDDDENVSLVNNFTCPYAYPKFYPFPFSISALLVIRRVLQKTKEIYPFNYNKVIILSLKTSVKTCIYLYIGQDPYSTSLTLFFIVTKLDSWVDWSFSKKFCFIGVVHG*
• ORF Type: complete

Annotations of Ll_transcript_418085

• Blastp: Chaperone protein DnaJ from Beijerinckia with 50.72% of identity
• Blastx: Chaperone protein DnaJ from Beijerinckia with 50.72% of identity
• Eggnog: ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins (By similarity)(COG0484)
• Kegg: Link to kegg annotations (Bind_0129)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455560.1)
• Pfam: DnaJ domain (PF00226.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;