Transcript | Ll_transcript_21930 |
---|---|
CDS coordinates | 136-828 (+) |
Peptide sequence | MNDSDVSKQIQQMVRFIQQEAEEKANEISVSAEEEFNIEKLQLVETDKKKIRQEYERKEKQVDIRKKIEYSMQLNASRIKVLQAQDDVVNNMKDAAAKELLNVSGDHNVYRNILKDLIVQSLLRLKEPSVLLRCREDDLQLVESVLDLAVQEYAEKANVHAPEIIVDKEVYLPPAPSDDNSHALHCSGGVVMASRDGKIVFENTLDARLDVVFRKNLPEIRKQLFGGAAA* |
ORF Type | complete |
Blastp | V-type proton ATPase subunit E from Citrus with 80% of identity |
---|---|
Blastx | V-type proton ATPase subunit E from Citrus with 80% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444647.1) |
Pfam | ATP synthase (E/31 kDa) subunit (PF01991.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer