Protein coding transcript 1933

• Transcript: Ll_transcript_352543
• CDS coordinates: 3-491 (+)
• Peptide sequence: GNTCRIVGTYGYMSPEYAMHGQFSEKSDVFSFGVILLEIISGKRNARSIFSDDLDDLLSCAWKQWRDETPFKILDQDIKESCNHSEVIKCIQIGLLCVQDRPDDRPTMAKIVSYFSSTHSEVDLPFPGEPINSLHNNQILQKMVVDESSSGSKQINELSMPR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_352543

• Blastp: Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 49.11% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 55.04% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G23180)
• CantataDB: Link to cantataDB annotations (CNT0000159)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452497.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;