Protein coding transcript 193325

• Transcript: Ll_transcript_20594
• CDS coordinates: 407-865 (+)
• Peptide sequence: MMDMGSEVQVRVSGGLLAILENERIVDTLEQTEFGNTSITIDSLAEISLNKFLKLDAAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGMINKCVTPMGRRLLRNWFLMPILDLDVLNYRLNSISFFVCSEELVSSLRETLKSVKDIPHLLKV*
• ORF Type: complete

Annotations of Ll_transcript_20594

• Blastp: DNA mismatch repair protein MSH5 from Arabidopsis with 81.46% of identity
• Blastx: DNA mismatch repair protein MSH5 from Arabidopsis with 79.25% of identity
• Eggnog: that it carries out the mismatch recognition step. This protein has a weak ATPase activity (By similarity)(COG0249)
• Kegg: Link to kegg annotations (AT3G20475)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435608.1)
• Pfam: MutS domain III (PF05192.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;