Transcript | Ll_transcript_19897 |
---|---|
CDS coordinates | 1-639 (+) |
Peptide sequence | RNLTILYLYHNSLSGEIPGVVEALNLTAIDLTKNDLTGKIPDDFGKLQKLTGLSLSQNKLSGEIPTSLGLLPSLIDFRVFFNNLSGTLPPDFGRSSNLGSFHIASNDLSGKLPENLCYYGELLNLTVYDNNLSGELPESLGNCSSLLDLKIDNNQFSGTIPSGLWTSFNLMNFMVSHNKFTGVLPEMLSSNISRFEISYNNFSGRIPAGVSPW |
ORF Type | internal |
Blastp | Receptor-like protein kinase HSL1 from Arabidopsis with 39.57% of identity |
---|---|
Blastx | Receptor-like protein kinase HSL1 from Arabidopsis with 39.57% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT1G28440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436604.1) |
Pfam | Leucine Rich Repeat (PF00560.32) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer