Protein coding transcript 193351

• Transcript: Ll_transcript_19881
• CDS coordinates: 1-879 (+)
• Peptide sequence: DEIGNLFNLETLDLSSNFELPRSSLPLSWTKLSKLKVFYMYSCNMVGEIPETIGEMVALEKLDISQNSLTGHIPSGLFMLKNLSILFLFLNTLSGEIPGVVEALNLTIIDLANNDLTGKIPDDFGKLQKLTGLSLSQNKLSGEIPTSLGLLPSLIDFRVFFNNLSGTLPPDFGRSSNLGSFHIASNDLSGKLPENLCYYGELLNLTVYDNNLSGELPESLGNCSSLLDLKIDNNQFSGTIPSGLWTSFNLMNFMVSHNKFTGVLPEMLSSNISRFEISYNNFSGRIPAGVSPW
• ORF Type: internal

Annotations of Ll_transcript_19881

• Blastp: Receptor-like protein kinase HSL1 from Arabidopsis with 38.46% of identity
• Blastx: Receptor-like protein kinase HSL1 from Arabidopsis with 38.46% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G28440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436604.1)
• Pfam: Leucine Rich Repeat (PF00560.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;