Transcript | Ll_transcript_19887 |
---|---|
CDS coordinates | 512-889 (+) |
Peptide sequence | MVEYVQTTRVSEKIDVFSFGVILLELTTGKKANKGDEHSSLAEWAWHQVHVGSNIEELLDKEIKEPSYLNEMCNAFKLGVMCTSTFPASRPSMKEAVQVLLRCGESLSNGERNICHYDVVPLLRD* |
ORF Type | complete |
Blastp | Probable leucine-rich repeat receptor-like protein kinase At2g33170 from Arabidopsis with 39.25% of identity |
---|---|
Blastx | Probable leucine-rich repeat receptor-like protein kinase At2g33170 from Arabidopsis with 39.25% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT2G33170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436604.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer