Protein coding transcript 193360

• Transcript: Ll_transcript_19887
• CDS coordinates: 512-889 (+)
• Peptide sequence: MVEYVQTTRVSEKIDVFSFGVILLELTTGKKANKGDEHSSLAEWAWHQVHVGSNIEELLDKEIKEPSYLNEMCNAFKLGVMCTSTFPASRPSMKEAVQVLLRCGESLSNGERNICHYDVVPLLRD*
• ORF Type: complete

Annotations of Ll_transcript_19887

• Blastp: Probable leucine-rich repeat receptor-like protein kinase At2g33170 from Arabidopsis with 39.25% of identity
• Blastx: Probable leucine-rich repeat receptor-like protein kinase At2g33170 from Arabidopsis with 39.25% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT2G33170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436604.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;