Protein coding transcript 193363

• Transcript: Ll_transcript_20265
• CDS coordinates: 2-697 (+)
• Peptide sequence: GYAVIFLYRRGSFQPFCRSLPDDPLVECFEPIDELDIQVREAYSEAVKRAVVDHHAAVTGGLLLKLPFNTIFEYLQMLQLVATSMRCLGPRAMFYLAAAVSDFYVPWKDMVEHKIQSGSHLLDVQLVQVPKMLSMLRKDWAPSAFCISFKLETNSNILLNKAATALEKYKMHAVVANELTTRKEQVVVVTRAENIIVQRDDSHSGNVLENPLIELLSARHAAYIKDSGSGK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_20265

• Blastp: Phosphopantothenate--cysteine ligase 1 from Arabidopsis with 65.2% of identity
• Blastx: Phosphopantothenate--cysteine ligase 1 from Arabidopsis with 65.2% of identity
• Eggnog: Phosphopantothenoylcysteine decarboxylase(COG0452)
• Kegg: Link to kegg annotations (AT1G12350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414249.1)
• Pfam: DNA / pantothenate metabolism flavoprotein (PF04127.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;