Protein coding transcript 19341

• Transcript: Ll_transcript_418962
• CDS coordinates: 101-406 (+)
• Peptide sequence: MRKPEQCGKNNSNKLRKGLWSPEEDEKLMNYIINNGQGCWSDVARNASLQRCGKSCRLRWINYLRPDLRRGAFSPQEEELIIHLHSLLGNRSTTYIFSSNI*
• ORF Type: complete

Annotations of Ll_transcript_418962

• Blastp: Transcription factor MYB46 from Arabidopsis with 73.4% of identity
• Blastx: Transcription factor MYB46 from Arabidopsis with 73.4% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT5G12870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457464.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;