Protein coding transcript 19348

• Transcript: Ll_transcript_417867
• CDS coordinates: 109-495 (+)
• Peptide sequence: MISGVEFKVPKFVVIGHRGHGMNALQSLDRRMKAIKENSIMSFNAAANFPIDFVEFDVQVTNDDCPVIFHDDFILSHENGVVFEKRITELRLSEFLAYGPQREVGKDGKVLVRKTKDGKIVQWKSFSQK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_417867

• Blastp: Glycerophosphodiester phosphodiesterase GDPD2 from Arabidopsis with 68.38% of identity
• Blastx: Glycerophosphodiester phosphodiesterase GDPD2 from Arabidopsis with 68.38% of identity
• Eggnog: glycerophosphoryl diester phosphodiesterase(COG0584)
• Kegg: Link to kegg annotations (AT5G41080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437407.1)
• Pfam: Glycerophosphoryl diester phosphodiesterase family (PF03009.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;