Protein coding transcript 193520

• Transcript: Ll_transcript_19998
• CDS coordinates: 121-894 (+)
• Peptide sequence: MEMKKNKHSGRVIAGPTNPMVTPLLTDLYQFTMAYAYWKAGKHQQRAVFDLYFRKNPFRGEYTIFAGLEECVRFISNYKLSDEEIDFIRSSLSISCEDGFFDYLRGIDCSDVEVYAIPEGSVVFPKIPLMRIEGPVAVVQLLETPFANLINYASLVSTNAARHRFVAGKSKTLLEFGLRRAQGPDGGVGASKYCYIGGFDATRYILLNNFNLCVWHKNREGMFTILCAYPKVIVLESYLAHVHRKSYALTHHMAIIN*
• ORF Type: complete

Annotations of Ll_transcript_19998

• Blastp: Nicotinate phosphoribosyltransferase 1 from Arabidopsis with 78.47% of identity
• Blastx: Nicotinate phosphoribosyltransferase 1 from Arabidopsis with 80.4% of identity
• Eggnog: Nicotinate phosphoribosyltransferase(COG1488)
• Kegg: Link to kegg annotations (AT4G36940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421314.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;