Protein coding transcript 193521

• Transcript: Ll_transcript_20000
• CDS coordinates: 2217-2981 (+)
• Peptide sequence: MRSGVPNFCAVALALNDLGYKAGGIRLDSGDLAYLSCEARKFFSSIEKEFGVSDFGKMSITASNDLNEETLDALNKQGHQVDAFGIGTYLVTCYAQAALGVVFKLVEINNQPRIKLSEDVSKVSIPCKKRCYRLYGKEGYPLVDIMTGENEPSPKVGERILCRHPFQESKRAYVVPQRVEELLRCYWPGISDKTRETLPPLKAIRERCIKQLEQMRPDHMRRLNPTPYKVSVSAKLYDFIHFLWLNEAPVGELQ*
• ORF Type: complete

Annotations of Ll_transcript_20000

• Blastp: Nicotinate phosphoribosyltransferase 2 from Arabidopsis with 86.22% of identity
• Blastx: Nicotinate phosphoribosyltransferase 2 from Arabidopsis with 84.76% of identity
• Eggnog: Nicotinate phosphoribosyltransferase(COG1488)
• Kegg: Link to kegg annotations (AT2G23420)
• CantataDB: Link to cantataDB annotations (CNT0002382)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446790.1)
• Pfam: Nicotinate phosphoribosyltransferase (NAPRTase) family (PF04095.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;