Transcript | Ll_transcript_20000 |
---|---|
CDS coordinates | 2217-2981 (+) |
Peptide sequence | MRSGVPNFCAVALALNDLGYKAGGIRLDSGDLAYLSCEARKFFSSIEKEFGVSDFGKMSITASNDLNEETLDALNKQGHQVDAFGIGTYLVTCYAQAALGVVFKLVEINNQPRIKLSEDVSKVSIPCKKRCYRLYGKEGYPLVDIMTGENEPSPKVGERILCRHPFQESKRAYVVPQRVEELLRCYWPGISDKTRETLPPLKAIRERCIKQLEQMRPDHMRRLNPTPYKVSVSAKLYDFIHFLWLNEAPVGELQ* |
ORF Type | complete |
Blastp | Nicotinate phosphoribosyltransferase 2 from Arabidopsis with 86.22% of identity |
---|---|
Blastx | Nicotinate phosphoribosyltransferase 2 from Arabidopsis with 84.76% of identity |
Eggnog | Nicotinate phosphoribosyltransferase(COG1488) |
Kegg | Link to kegg annotations (AT2G23420) |
CantataDB | Link to cantataDB annotations (CNT0002382) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446790.1) |
Pfam | Nicotinate phosphoribosyltransferase (NAPRTase) family (PF04095.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer