Protein coding transcript 193526

• Transcript: Ll_transcript_19985
• CDS coordinates: 335-1267 (+)
• Peptide sequence: MEAKKENGGTIPGPTNPMVTPLLTDLYQFTMAYAYWKAGKHQERAVFDLYFRKNPFGGEYTVFAGLEEVIRFIANFRFTEEEIAFIRESLTDSCEDGFFDYLRGIDCSDVEVYAIPEGTVVFPKIPLLRIEGPIAIVQLLETPFVNLINYASLVSTNAARHRNVAGKSKTLLEFGLRRAQGPDGGIGASKYCYIGGFDATSNVAAGKLFGIPLRGTHSHAFVSSYMGLDEIIDKSLRKKDGSSTCEDFVSLVQTWLSKIQWSNSLRGIFGETNQSELAAFISYAQAFPNKFLALVDTYDEKSCLSLLHAF*
• ORF Type: complete

Annotations of Ll_transcript_19985

• Blastp: Nicotinate phosphoribosyltransferase 1 from Arabidopsis with 80.34% of identity
• Blastx: Nicotinate phosphoribosyltransferase 1 from Arabidopsis with 80.34% of identity
• Eggnog: Nicotinate phosphoribosyltransferase(COG1488)
• Kegg: Link to kegg annotations (AT4G36940)
• CantataDB: Link to cantataDB annotations (CNT0002382)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431834.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;