Protein coding transcript 193527

• Transcript: Ll_transcript_20005
• CDS coordinates: 265-741 (+)
• Peptide sequence: MKSGVPNFCAVALALNDLGYKAGGIRLDSGDLAYLSCEARKFFCAIEKEFGVPEFGKMFITASNDLNEETIDALNKHGHEIDAFGIGTYLVTCYAQAALGVVFKLVEINNQPRIKLSEDVSKVSIPCKKRSYRLYGKEGYPLVDIMTGENEPSPKVLS*
• ORF Type: complete

Annotations of Ll_transcript_20005

• Blastp: Nicotinate phosphoribosyltransferase 2 from Arabidopsis with 87.82% of identity
• Blastx: Nicotinate phosphoribosyltransferase 2 from Arabidopsis with 87.42% of identity
• Eggnog: Nicotinate phosphoribosyltransferase(COG1488)
• Kegg: Link to kegg annotations (AT2G23420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431834.1)
• Pfam: Nicotinate phosphoribosyltransferase (NAPRTase) family (PF04095.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;