Protein coding transcript 193534

• Transcript: Ll_transcript_19992
• CDS coordinates: 211-555 (+)
• Peptide sequence: MEAKKENSGVIAGPTNPMVTPLLTDLYQFTMAYAYWKAGKHQERAVFDLYFRKNPFGGEYTVFAGLEEVIRFIANFRLTEEEIAFIRESLSDSCEVNQFVIITAAIKRILYSGE*
• ORF Type: complete

Annotations of Ll_transcript_19992

• Blastp: Nicotinate phosphoribosyltransferase 2 from Arabidopsis with 73.2% of identity
• Blastx: Nicotinate phosphoribosyltransferase 2 from Arabidopsis with 73.2% of identity
• Eggnog: Nicotinate phosphoribosyltransferase(COG1488)
• Kegg: Link to kegg annotations (AT2G23420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446790.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;