Transcript | Ll_transcript_417457 |
---|---|
CDS coordinates | 1624-2382 (+) |
Peptide sequence | MLLGFVSYRFDILSSPETSQRQLQICVDVENAKCSICLNIWHDVVTVAPCLHNFCNGCFSEWLRRSQEKRSSVLCPQCRGVVQFVGKNHFLRTIAEDMLKADSSLRRSDEEVALLDTYSSVRSNLVIGSGKKNCRKRAHTPVDDQSDGTYLQCPQCVHEVGGFHCNNNTVHLQCQACGGMMPSRLGFNIPQYCSGCDRSFCGAYWHALGVTGSGPYPICSQDTLKPISEHSISRIPLLAHENNVHEQNVCAF* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase CHFR from Pongo with 25.32% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase CHFR from Pongo with 25.32% of identity |
Eggnog | zinc ion binding(COG5243) |
Kegg | Link to kegg annotations (100171543) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458160.1) |
Pfam | Ring finger domain (PF13639.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer