Protein coding transcript 193605

• Transcript: Ll_transcript_21810
• CDS coordinates: 972-1334 (+)
• Peptide sequence: MVDNIPVREFKYSSTFYPSKAMSVYCTIWDGSEWATHGGKYPVNYKYAPFNVSFSEMELSGCISDPTTTLSSCSKVTPSSDFTKLSQQQITAMDWARRKLMFYSYCNDKTRFKVLPPECN*
• ORF Type: complete

Annotations of Ll_transcript_21810

• Blastp: Probable xyloglucan endotransglucosylase/hydrolase protein 33 from Arabidopsis with 59.7% of identity
• Blastx: Probable xyloglucan endotransglucosylase/hydrolase protein 33 from Arabidopsis with 62.32% of identity
• Eggnog: hydrolase family 16(COG2273)
• Kegg: Link to kegg annotations (AT1G10550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422717.1)
• Pfam: Glycosyl hydrolases family 16 (PF00722.20)
• Rfam: Plant_SRP (RF01855)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;