Transcript | Ll_transcript_21815 |
---|---|
CDS coordinates | 1072-1434 (+) |
Peptide sequence | MVDNIPVREFKYSSTFYPSKAMSVYCTIWDGSEWATHGGKYPVNYKYAPFNVSFSEMELSGCISDPTTTLSSCSKVTPSSDFTKLSQQQITAMDWARRKLMFYSYCNDKTRFKVLPPECN* |
ORF Type | complete |
Blastp | Probable xyloglucan endotransglucosylase/hydrolase protein 33 from Arabidopsis with 59.7% of identity |
---|---|
Blastx | Probable xyloglucan endotransglucosylase/hydrolase protein 33 from Arabidopsis with 62.32% of identity |
Eggnog | hydrolase family 16(COG2273) |
Kegg | Link to kegg annotations (AT1G10550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422717.1) |
Pfam | Glycosyl hydrolases family 16 (PF00722.20) |
Rfam | Plant_SRP (RF01855) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer