Protein coding transcript 193607

• Transcript: Ll_transcript_21816
• CDS coordinates: 94-1005 (+)
• Peptide sequence: MALWQQKLLFSPLLIILCLLATLVSPHSRPFTTPTVTRLTDSFPHVKVDATFSKAFGDSNLQFLNNGSMATIALDKNSGSGLVSKSRYYNGFFSAAIKLPAGLSSGVVVAFYLSNADKFPHNHDEIDIELLGHDKRNDWVFQTNIYANGSVNTGREEKFYFWFDPTQQYHYYSILWNSYHTLFMVDNIPVREFKYSSTFYPSKAMSVYCTIWDGSEWATHGGKYPVNYKYAPFNVSFSEMELSGCISDPTTTLSSCSKVTPSSDFTKLSQQQITAMDWARRKLMFYSYCNDKTRFKVLPPECN*
• ORF Type: complete

Annotations of Ll_transcript_21816

• Blastp: Probable xyloglucan endotransglucosylase/hydrolase protein 33 from Arabidopsis with 60.32% of identity
• Blastx: Probable xyloglucan endotransglucosylase/hydrolase protein 33 from Arabidopsis with 62.59% of identity
• Eggnog: hydrolase family 16(COG2273)
• Kegg: Link to kegg annotations (AT1G10550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422717.1)
• Pfam: Glycosyl hydrolases family 16 (PF00722.20)
• Rfam: Plant_SRP (RF01855)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;