Protein coding transcript 19361

• Transcript: Ll_transcript_417447
• CDS coordinates: 1137-1895 (+)
• Peptide sequence: MLLGFVSYRFDILSSPETSQRQLQICVDVENAKCSICLNIWHDVVTVAPCLHNFCNGCFSEWLRRSQEKRSSVLCPQCRGVVQFVGKNHFLRTIAEDMLKADSSLRRSDEEVALLDTYSSVRSNLVIGSGKKNCRKRAHTPVDDQSDGTYLQCPQCVHEVGGFHCNNNTVHLQCQACGGMMPSRLGFNIPQYCSGCDRSFCGAYWHALGVTGSGPYPICSQDTLKPISEHSISRIPLLAHENNVHEQNVCAF*
• ORF Type: complete

Annotations of Ll_transcript_417447

• Blastp: E3 ubiquitin-protein ligase CHFR from Pongo with 25.32% of identity
• Blastx: E3 ubiquitin-protein ligase CHFR from Pongo with 25.32% of identity
• Eggnog: zinc ion binding(COG5243)
• Kegg: Link to kegg annotations (100171543)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458160.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;