Protein coding transcript 193611

• Transcript: Ll_transcript_22083
• CDS coordinates: 111-578 (+)
• Peptide sequence: MTVAPSLSLPHLHSSFVSCPLKSFSPSLKTRIQPKPTFYPRIKALEFDQNTVLAITVGVVSVAVGIGVPVFYESQIDNAAKRDNTQPCFPCNGSGAQKCRFCLGTGNVTVELGGGENEVSRCINCDGAGSLTCTTCQGSGIQPRYLDRREFKDDD*
• ORF Type: complete

Annotations of Ll_transcript_22083

• Blastp: Protein disulfide-isomerase LQY1, chloroplastic from Arabidopsis with 75.17% of identity
• Blastx: Protein disulfide-isomerase LQY1, chloroplastic from Arabidopsis with 75.18% of identity
• Eggnog: NA(ENOG4111Q7U)
• Kegg: Link to kegg annotations (AT1G75690)
• CantataDB: Link to cantataDB annotations (CNT0000530)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436851.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;