Transcript | Ll_transcript_19971 |
---|---|
CDS coordinates | 906-1739 (+) |
Peptide sequence | MSSIQKSIVYGSLGSEPTSEAGDVYNMLIFGVIQLVLSQTPNFHNIQWLSVVAAIMSLGYAFTGMGLAVVKVAENGHAEGSTKGIPTSTEMAKFWLVAQALGDIAFSYPFSVILIEIQDTLKSPPPENVTMRKASTISVFITTFFYLCCGCAGYAAFGNDTPGNLLTGFALSKPHWLVDFANVCIVIHLVGAYQVYSQPLFANFENWLRFKYPDSEFVNHVYLLQLPLLPAFELNFLRLSFRTAYVASTIVIAMLFPYFNQILGVLGGIIFWPLTIYF |
ORF Type | 3prime_partial |
Blastp | Probable amino acid permease 7 from Arabidopsis with 57.3% of identity |
---|---|
Blastx | Probable amino acid permease 7 from Arabidopsis with 55.77% of identity |
Eggnog | amino acid transport(COG0814) |
Kegg | Link to kegg annotations (AT5G23810) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430870.1) |
Pfam | Transmembrane amino acid transporter protein (PF01490.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer