Protein coding transcript 193705

• Transcript: Ll_transcript_20223
• CDS coordinates: 179-730 (+)
• Peptide sequence: MLCAYFFLQARGVNYLHHYNPPIIHRDLKSSNILVDKNWTVKVGDFGLSRLKYEAFLTTKTGRGTPQWMAPEVLRNEPSDEKSDVYSFGVILWELATKKIPWDTLNITQVTGAVGFMNHRLEIPEDVDPQWACIIKSCWHSDSACRPTFEELLERLKELQKQFAVKFQAAARSNGRESNQKES*
• ORF Type: complete

Annotations of Ll_transcript_20223

• Blastp: Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 62.5% of identity
• Blastx: Serine/threonine-protein kinase CTR1 from Arabidopsis with 65.71% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G73660)
• CantataDB: Link to cantataDB annotations (CNT0002789)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425313.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;