Protein coding transcript 193706

• Transcript: Ll_transcript_20226
• CDS coordinates: 113-460 (+)
• Peptide sequence: MAPEVLRNEPSDEKSDVYSFGVILWELATKKIPWDTLNITQVTGAVGFMNHRLEIPEDVDPQWACIIKSCWHSDSACRPTFEELLERLKELQKQFAVKFQAAARSNGRESNQKES*
• ORF Type: complete

Annotations of Ll_transcript_20226

• Blastp: Serine/threonine-protein kinase EDR1 from Arabidopsis with 62.37% of identity
• Blastx: Serine/threonine-protein kinase CTR1 from Arabidopsis with 63.64% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G08720)
• CantataDB: Link to cantataDB annotations (CNT0002789)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425309.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;