| Transcript | Ll_transcript_20213 |
|---|---|
| CDS coordinates | 1-423 (-) |
| Peptide sequence | MPAWITSVPVGPRSGTQKRPAALSPAIRDDFISRRNFSAFAAAAAAAAEADSDDSDGIKSSSGTRGRGGREESEKDCEFGYRELANAIERFGEIYERVESAKQRQMVELEKQRMQFTKDLEVQRMQMFMDTQVQLERIKRG |
| ORF Type | 3prime_partial |
| Blastp | Trihelix transcription factor ASIL2 from Arabidopsis with 55% of identity |
|---|---|
| Blastx | Trihelix transcription factor ASIL2 from Arabidopsis with 55% of identity |
| Eggnog | NA(ENOG410Z419) |
| Kegg | Link to kegg annotations (AT3G14180) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453671.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer