Transcript | Ll_transcript_20555 |
---|---|
CDS coordinates | 136-609 (+) |
Peptide sequence | MQASRARLFKEYKEVQREKSADPDITLVCDDSNIFKWNALIKGPSETPYEEGVFQLAFSVPEQYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDVRGFQSMARMYTRLAAMPKKG* |
ORF Type | complete |
Blastp | Protein PEROXIN-4 from Arabidopsis with 94.27% of identity |
---|---|
Blastx | Protein PEROXIN-4 from Arabidopsis with 94.27% of identity |
Eggnog | ubiquitin-conjugating enzyme(COG5078) |
Kegg | Link to kegg annotations (AT5G25760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438412.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer