Protein coding transcript 193798

• Transcript: Ll_transcript_20566
• CDS coordinates: 556-1011 (+)
• Peptide sequence: MKVYPNELTVIFFYNLCVSILAAIVAIFAEKNPSAWNIGVDIALASVICSGIFGSFLNNAVHTWVLRIKGPVYVAMFKPLSIVIAVTLGVIFLGDTLHLGSVIGAIIISIGFYTVMWGKSKEEVNEDVPSHELPTTENVPLLQSYKSDRSE*
• ORF Type: complete

Annotations of Ll_transcript_20566

• Blastp: WAT1-related protein At3g28050 from Arabidopsis with 53.61% of identity
• Blastx: WAT1-related protein At3g28050 from Arabidopsis with 53.76% of identity
• Eggnog: Nodulin MtN21 family protein(ENOG4111ADX)
• Kegg: Link to kegg annotations (AT3G28050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456751.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;