Protein coding transcript 193800

• Transcript: Ll_transcript_20569
• CDS coordinates: 77-925 (+)
• Peptide sequence: MYRIGLLGLIGCLSNTVGYTGISLSSPTLSSAISNLVPAITFLLAIIFRMEKVTKSASSKAKIIGTIVSISGAFAVTLYKGPTIIAHTPSISLHKPINTLNSEDQNWIIGGLLLTTEYTLIPLWYIVQVQIMKVYPNELTVIFFYNLCVSILAAIVAIFAEKNPSAWNIGVDIALASVICSGIFGSFLNNAVHTWVLRIKGPVYVAMFKPLSIVIAVTLGVIFLGDTLHLGSVIGAIIISIGFYTVMWGKSKEEVNEDVPSHELPTTENVPLLQSYKSDRSE*
• ORF Type: complete

Annotations of Ll_transcript_20569

• Blastp: WAT1-related protein At3g28050 from Arabidopsis with 56.52% of identity
• Blastx: WAT1-related protein At3g28050 from Arabidopsis with 56.29% of identity
• Eggnog: Nodulin MtN21 family protein(ENOG4111ADX)
• Kegg: Link to kegg annotations (AT3G28050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456751.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;