Protein coding transcript 193808

• Transcript: Ll_transcript_20103
• CDS coordinates: 159-731 (+)
• Peptide sequence: MMAVKKSNCFHHSGHKDPCHMSSNNYMIIFGVTQMFLSQIPDFDQIWWLSIVAAVMSFTYSIIGLALGIAKVAANRTFKGSLTGISIGQNVSETQKIWRTSQALGDIAFAYSYAVVLIEIQDTIKSPPSEAKTMKKATMISIAVTTTFYMLCGCMGYAAFGNEAPGNLLTGFGFYDPYWLVDIANVAIVVH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_20103

• Blastp: Amino acid permease 2 from Arabidopsis with 81.15% of identity
• Blastx: Amino acid permease 2 from Arabidopsis with 79.19% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT5G09220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462937.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;