Transcript | Ll_transcript_418422 |
---|---|
CDS coordinates | 312-1514 (+) |
Peptide sequence | MGSAPSTPRKDTAFSPEYLIGSFVGDKSFSIDSDLWHQLLLIPLNLQWPTHHVQQACLLLAKNNCHTRHLAKILFHLACCLQESMSTSDVSPLVYEKAMSAVYISSVFLKHLIESVQGDSLDLYLSLDHCEDAPKDILGDQSVENLVMRNVLNFIVSVDVSPDTYLLHLELLNFMVIAMSTQLLCGPSPGPDDVNPFLDAAMAQDSSLVSSVVCRMLLNFIARPSIPFNRASYSIFHDGSQSSVLQRVGSAAANIVLSPFSYLVTSGGEGGSISPIADSSLHVLLVLIHYHKCVANEDHSAIENNKSSASDSLLKENPHFSDNPYCKALEHTVDCELDRVDVEGSAHNGRHVKLPFATLFDTLGICLADETAVLLLYSLLQGNSAFMEYVLVRTDLDTLV* |
ORF Type | complete |
Blastp | Dymeclin from Dictyostelium with 23.04% of identity |
---|---|
Blastx | Dymeclin from Dictyostelium with 22.97% of identity |
Eggnog | dymeclin(ENOG410XP0J) |
Kegg | Link to kegg annotations (DDB_G0292524) |
CantataDB | Link to cantataDB annotations (CNT0001902) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442180.1) |
Pfam | Dyggve-Melchior-Clausen syndrome protein (PF09742.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer