| Transcript | Ll_transcript_20134 |
|---|---|
| CDS coordinates | 480-827 (+) |
| Peptide sequence | MWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKNIPIHHIPGPEGVRGRNSDNTLIKEKLGWAPTMKLKVLILVLGEITFLYPLYNYFQSSD* |
| ORF Type | complete |
| Blastp | GDP-mannose 3,5-epimerase 1 from Oryza sativa with 95.65% of identity |
|---|---|
| Blastx | GDP-mannose 3,5-epimerase 2 from Oryza sativa with 92.44% of identity |
| Eggnog | Nad-dependent epimerase dehydratase(COG0451) |
| Kegg | - |
| CantataDB | Link to cantataDB annotations (CNT0001917) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452214.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer