Protein coding transcript 193865

• Transcript: Ll_transcript_20135
• CDS coordinates: 3-359 (+)
• Peptide sequence: ACIYPEFKQLETNVCLKEADAGPAEPQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKTLTSTDRFEMWGDGLQTRSFTFIDACVEGVLRLTKSDF
• ORF Type: internal

Annotations of Ll_transcript_20135

• Blastp: GDP-mannose 3,5-epimerase 1 from Oryza sativa with 93.28% of identity
• Blastx: GDP-mannose 3,5-epimerase 1 from Oryza sativa with 93.28% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003626450.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;