Protein coding transcript 193867

• Transcript: Ll_transcript_20137
• CDS coordinates: 609-1040 (+)
• Peptide sequence: MWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKNIPIHHIPGPEGVRGRNSDNTLIKEKLGWAPTMKLKDGLRITYFWIKEQLEKEKDKGIDLSLYGTSKVVQTQAPVQLGSLRAADGKE*
• ORF Type: complete

Annotations of Ll_transcript_20137

• Blastp: GDP-mannose 3,5-epimerase 2 from Oryza sativa with 93.71% of identity
• Blastx: GDP-mannose 3,5-epimerase 2 from Oryza sativa with 93.75% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (4350816)
• CantataDB: Link to cantataDB annotations (CNT0001917)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452214.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;