Transcript | Ll_transcript_20767 |
---|---|
CDS coordinates | 95-406 (+) |
Peptide sequence | MGCVGSSQSKVDGALKKIRKPKPWKHPQPITKTQLMQLRDEFWDTSPHYGGRKEIWDALRAAAEADDLSLAQAIVDSAGVIVQSSDLTVCYDERDYGGTISLF* |
ORF Type | complete |
Blastp | Ubiquitin domain-containing protein 1 from Silurana with 49.09% of identity |
---|---|
Blastx | Ubiquitin domain-containing protein 1 from Danio with 47.66% of identity |
Eggnog | Ubiquitin domain containing(ENOG410XRPV) |
Kegg | Link to kegg annotations (448143) |
CantataDB | Link to cantataDB annotations (CNT0000677) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425711.1) |
Pfam | Ubiquitin-binding domain (PF16455.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer