| Transcript | Ll_transcript_418435 |
|---|---|
| CDS coordinates | 393-770 (+) |
| Peptide sequence | MPILEALYNAPRRTANQIYMLLIILLILSQDSSFNASIHKLILPTIPWYKERLLHQTSLGSLMVIILIRTVQYNLSKLRDVYLHSTCLATLANMAPHVHQLSAYASQRLVGLFYMLSRKYNKLADL |
| ORF Type | 3prime_partial |
| Blastp | Dymeclin from Gallus with 52.85% of identity |
|---|---|
| Blastx | Dymeclin from Gallus with 51.59% of identity |
| Eggnog | dymeclin(ENOG410XP0J) |
| Kegg | Link to kegg annotations (426843) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019432529.1) |
| Pfam | Dyggve-Melchior-Clausen syndrome protein (PF09742.8) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer