Transcript | Ll_transcript_418413 |
---|---|
CDS coordinates | 2488-3183 (+) |
Peptide sequence | MAPHVHQLSAYASQRLVGLFYMLSRKYNKLADLRDNKIDNAKGNLIEGSSVVKDVSAELHIYTDFLRLVLEIINAILTYALPRNPEVVYSIMQKQEVFQPFKNHPSFNELLENIYTVLDYFESRMDAQRMDGNWSVNEVLQVIIVNCRSWRVEGMKMFTQLHFTYEQESHPEEFFIPYVWQLVLSKCGFKFNTAAINLFPVDPPTERLENGVVGSTLRNSDIEKSEYELDP* |
ORF Type | complete |
Blastp | Dymeclin from Dictyostelium with 23.06% of identity |
---|---|
Blastx | Dymeclin from Xenopus with 38.71% of identity |
Eggnog | dymeclin(ENOG410XP0J) |
Kegg | Link to kegg annotations (DDB_G0292524) |
CantataDB | Link to cantataDB annotations (CNT0001914) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432529.1) |
Pfam | Dyggve-Melchior-Clausen syndrome protein (PF09742.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer