Transcript | Ll_transcript_418432 |
---|---|
CDS coordinates | 186-1175 (+) |
Peptide sequence | MHNFFISRFIPSFPIPHPQFHLNLLRHNAFLFFNPFTSQSQGDEQKDLNFAVSYLITSCGFSPETATRVSKHVQFKTLDKPNAVLALLKKYGFNETQIGRFVLKRPLVLVADAETTLLPKLKFYQSIGISTTVLPKLMLKNHTFLTRSLDKFIIPRYKILRSVVRSDEEVVGALKRGALAFMYCDLINNLIPNIDVLKQLCVPQASISHLVMYYPGTGYIAHSRFVEGVNLAKELGFDPLKVSFIGALHVLVNLERARWESRLQSYQNWGWSREISLSAFRKFSNFHVAYRGEVCEIDEFPCESYGLAVRGYCCLPCGSCIQLGEEDYP* |
ORF Type | complete |
Blastp | Transcription termination factor MTERF6, chloroplastic/mitochondrial from Arabidopsis with 26.06% of identity |
---|---|
Blastx | Transcription termination factor MTERF6, chloroplastic/mitochondrial from Arabidopsis with 26.06% of identity |
Eggnog | mitochondrial transcription termination(ENOG410XT49) |
Kegg | Link to kegg annotations (AT4G38160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435347.1) |
Pfam | mTERF (PF02536.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer