Protein coding transcript 194020

• Transcript: Ll_transcript_20421
• CDS coordinates: 2064-2492 (+)
• Peptide sequence: MLVARGTIGYIAPEVFCRNIGVVSYKSDVYSFGMLVLEMVGGRKNINVEVECTSEIYFPYWIYKRIELNEELALRNIMDDSDREKIKKMILVSLWCIQTNPSDRPTMHRVVEMLEGNVETLQVPPKPFLSSPSVSPHSSPSH*
• ORF Type: complete

Annotations of Ll_transcript_20421

• Blastp: Rust resistance kinase Lr10 from Triticum with 52.67% of identity
• Blastx: Rust resistance kinase Lr10 from Triticum with 51.24% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000673)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459560.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;