Transcript | Ll_transcript_20422 |
---|---|
CDS coordinates | 2372-2800 (+) |
Peptide sequence | MLVARGTIGYIAPEVFCRNIGVVSYKSDVYSFGMLVLEMVGGRKNINVEVECTSEIYFPYWIYKRIELNEELALRNIMDDSDREKIKKMILVSLWCIQTNPSDRPTMHRVVEMLEGNVETLQVPPKPFLSSPSVSPHSSPSH* |
ORF Type | complete |
Blastp | Rust resistance kinase Lr10 from Triticum with 52.67% of identity |
---|---|
Blastx | Rust resistance kinase Lr10 from Triticum with 50% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000673) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459560.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer