Protein coding transcript 194113

• Transcript: Ll_transcript_20100
• CDS coordinates: 487-1176 (+)
• Peptide sequence: MFLVNIFMAGIIFANEIKATRLKSLTANLHRLGVSNTVVCNYDGKELPKVLGQNAVDRVLLDAPCSGTGVISKDESVKTSKDLEDIQKCAQLQKELILAAIDMVDANSKSGGYIVYSTCSIMVAENEAVIDYALKKRDVKLVPCGLDFGRPGFTKFRELRFHPSLEKTRRFYPHVHNMDGFFVAKLKKMSSSKPNSKLSEPSENEEEETELVEEEETGLVEEEEKPSNDL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_20100

• Blastp: Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase from Homo with 68.62% of identity
• Blastx: Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase from Homo with 62.04% of identity
• Eggnog: nOP2 Sun(COG0144)
• Kegg: Link to kegg annotations (4839)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447055.1)
• Pfam: 16S rRNA methyltransferase RsmB/F (PF01189.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;