Protein coding transcript 194114

• Transcript: Ll_transcript_20101
• CDS coordinates: 879-2048 (+)
• Peptide sequence: MFPVVELLQLIEAFEKPRPMCLRTNTLKTRRRDLADVLINRGVNLDPLSKWSKVGLVVYDSQVPIGATPEYMAGFYMLQGASSFLPVMALAPQEKERVVDMAAAPGGKTTYIAALMKNTGIIYANEIKVSRLKSLTANLHRMGVTNTVVCNYDAKELPKVLGQNTVDRILLDAPCSGTGVISKDESVKTSKDLEDIQKCARLQKELILAAIDMVDANSKSGGYIVYSTCSIMVAENEAVIDYALKKRDVKLVPCGLDFGRPGFTKFREQRFHPTLEKTRRFYPHVHNMDGFFVAKLKKMSSSSKPSATSEPLEKEEEGIELVKEEKASNGRKENGKDSPESKSKKEKKKNFAPKQSNDIKENGEESSESKSKKDKKRKFPPKPSNDIKEN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_20101

• Blastp: Probable 28S rRNA (cytosine-C(5))-methyltransferase from Mus with 62.84% of identity
• Blastx: Probable 28S rRNA (cytosine-C(5))-methyltransferase from Mus with 71.77% of identity
• Eggnog: nOP2 Sun(COG0144)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426277.1)
• Pfam: N-terminal domain of 16S rRNA methyltransferase RsmF (PF17125.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;