Protein coding transcript 194116

• Transcript: Ll_transcript_20088
• CDS coordinates: 487-945 (+)
• Peptide sequence: MFLVNIFMAGIIFANEIKATRLKSLTANLHRLGVSNTVVCNYDGKELPKVLGQNAVDRVLLDAPCSGTGVISKDESVKTSKDLEDIQKCAQLQKELILAAIDMVDANSKSGGYIVYSTCSIMVAENEAVIDYALKKRDVKLVPCGLDFGRPG*
• ORF Type: complete

Annotations of Ll_transcript_20088

• Blastp: Probable 28S rRNA (cytosine-C(5))-methyltransferase from Mus with 67.83% of identity
• Blastx: Probable 28S rRNA (cytosine-C(5))-methyltransferase from Mus with 59.65% of identity
• Eggnog: nOP2 Sun(COG0144)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447055.1)
• Pfam: 16S rRNA methyltransferase RsmB/F (PF01189.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;