Protein coding transcript 194140

• Transcript: Ll_transcript_22226
• CDS coordinates: 3-305 (-)
• Peptide sequence: AASRLASATPPPAHVLSRGVGWQGIGILLNGLFGTLTGSTVSVENVGLLGSTRVGSRRVVQISAGFMIFFSMLGKFGALFASIPFPIFAAAYCVLFGLVAS
• ORF Type: internal

Annotations of Ll_transcript_22226

• Blastp: Nucleobase-ascorbate transporter 2 from Arabidopsis with 91.09% of identity
• Blastx: Nucleobase-ascorbate transporter 2 from Arabidopsis with 91.09% of identity
• Eggnog: permease(COG2233)
• Kegg: Link to kegg annotations (AT2G34190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439629.1)
• Pfam: Permease family (PF00860.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;