Protein coding transcript 194179

• Transcript: Ll_transcript_21687
• CDS coordinates: 605-1399 (+)
• Peptide sequence: MKKEVKYLPVLGWSMWFSDYLFLERNWAKDEAALKTGFQHLNHIPVPFWLALFVEGTRFTHTKLLAAQEFAVSRGLPVPRNVLIPRTKGFVTAVEQTRGTIPAIYDCTFAVPKNETSPTLLRMIKGISCSVKVQIKRHKMEELPETSDGIAQWCKETFVTKDAILEKYNTTNIFSEQELQQLGRPKRSVMVIISWSCLLGFLLYKFFKWTSLLSTWQGIIFTLLFLVLVTVIMEILIHSSESERSKSNMILPTQDPMKQKLLHS*
• ORF Type: complete

Annotations of Ll_transcript_21687

• Blastp: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 from Arabidopsis with 56.06% of identity
• Blastx: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 from Arabidopsis with 53.19% of identity
• Eggnog: Acyltransferase(COG0204)
• Kegg: Link to kegg annotations (AT1G51260)
• CantataDB: Link to cantataDB annotations (CNT0000721)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436585.1)
• Pfam: Acyltransferase (PF01553.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;