Transcript | Ll_transcript_352512 |
---|---|
CDS coordinates | 66-671 (+) |
Peptide sequence | METDDKTPKTRKVKKQVRKGDLPISAGTASLSNEVREQYFEMEGSMQSEDKLVAETEDKKNELEGDIYALRNKVDEPYEQNGYSEFASEEEKEKIKAKCEALEDWLYDDGEDASKAQYVSKHEELRSTAASVIQRFNERRQQEEDERRAKAEAEAAKKREEEEAKRQADAEAAAAAQAAKKMADQRAAAEAAQQKDEEMKDA |
ORF Type | 3prime_partial |
Blastp | Heat shock protein hsp88 from Neurospora with 56.17% of identity |
---|---|
Blastx | Heat shock protein hsp88 from Neurospora with 57.69% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (NCU05269) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457564.1) |
Pfam | Hsp70 protein (PF00012.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer