Protein coding transcript 194206

• Transcript: Ll_transcript_22317
• CDS coordinates: 1972-2517 (+)
• Peptide sequence: MTSESCQNGTERCNEALQKLGKKYDVVVNIQGDEPLIEPEIIDGVVKALQADPDAVFSTAVTSLNPEDAHDPNRVKCVVDNRGYAIYFSRGLIPFNKSGKINQQFPYLLHLGIQSYDAKFLKIYPYLQPTPLQLEEDLEQLKVLENGYKMKVVKVDHEAHGVDTPEDVQKIESLMLERNLA*
• ORF Type: complete

Annotations of Ll_transcript_22317

• Blastp: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial from Arabidopsis with 86.19% of identity
• Blastx: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial from Arabidopsis with 86.21% of identity
• Eggnog: Activates KDO (a required 8-carbon sugar) for incorporation into bacterial lipopolysaccharide in Gram-negative bacteria (By similarity)(COG1212)
• Kegg: Link to kegg annotations (AT1G53000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413598.1)
• Pfam: Cytidylyltransferase (PF02348.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;