Transcript | Ll_transcript_22450 |
---|---|
CDS coordinates | 389-1387 (+) |
Peptide sequence | MASMAATLFVPFQVSKTFDTHFAPSSKVNIFGGAKARTHQGLRVSSGLIEPDGGKLVELVVKDSERDLKKGEAFSLPRIKLSRIDLEWVHVLSEGWASPLNGFMKESEFLQTLHFNSIRLNDGSVVNMSLPIVLPIDDSQKHRIGDSKKVALFDSLGNPIAILNNIEIYKHPKEERIARTWGTTAPGLPYVEEAISKAGNWLIGGDLEVIEPIKYHDGLDHFRLSPAELRDEFKKRNADAVFAFQLRNPVHNGHALLMTDTRKRLLDMGYKNPVLLLHPLGGYTKADDVPLDWRMKQHEKVLEDGVLDPQTTVVSIFPSPMHYAGPTEVQWHA |
ORF Type | 3prime_partial |
Blastp | ATP sulfurylase 1, chloroplastic from Arabidopsis with 75.07% of identity |
---|---|
Blastx | ATP sulfurylase 1, chloroplastic from Arabidopsis with 75.07% of identity |
Eggnog | Catalyzes the first intracellular reaction of sulfate assimilation, forming adenosine-5'-phosphosulfate (APS) from inorganic sulfate and ATP. Plays an important role in sulfate activation as a component of the biosynthesis pathway of sulfur- containing amino acids (By similarity)(COG2046) |
Kegg | Link to kegg annotations (AT3G22890) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427061.1) |
Pfam | PUA-like domain (PF14306.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer